IGF1 – LR3 (1mg)
A synthetic peptide derived from a naturally occurring gut protein. Commonly used in research to study cellular regeneration, tissue repair, and gastrointestinal biology.
All our research peptides are third-party tested and supplied with a Certificate of Analysis (CoA). Each batch is independently verified for purity, identity, and molecular quality, providing researchers with reliable, high-quality materials for laboratory and in vitro studies.
£ 60.00
Description
Research Peptide for Laboratory Use
IGF-1 LR3 is widely utilised in controlled research environments studying cellular processes, growth factor signalling, and protein interactions. Its structural modification allows researchers to explore prolonged receptor activity compared to unmodified IGF-1.
Key Features:
- Research-grade IGF-1 LR3 peptide (Long R³ IGF-1)
- 83 amino acid synthetic peptide sequence
- Enhanced stability compared to native IGF-1
- High purity, laboratory-tested material (where applicable)
- Supplied for in vitro laboratory research only
Molecular Information:
- Molecular weight: ~9,120 g/mol (approx. 9.1 kDa)
- Sequence length: 83 amino acids
- Form: Lyophilised powder (typical format for research peptides)
Research Applications:
IGF-1 LR3 is commonly used in controlled laboratory environments for studies involving:
- Cell growth and differentiation pathways
- IGF-1 receptor (IGF-1R) signalling mechanisms
- Protein binding interactions and bioavailability research
- Comparative studies with native IGF-1
Important Legal Notice:
This product is sold strictly for laboratory research purposes only. It is not a medicinal product, dietary supplement, or food item, and is not intended for human or veterinary use. It must only be handled by qualified professionals in a controlled research environment.
Peptide length - 83 amino acids
Sequence - MFPAMPLSSLFVNGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molecular weight 9,129 g/mol
Molecular formula - Approximate empirical formula C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
